General Information

  • ID:  hor000943
  • Uniprot ID:  P09859
  • Protein name:  Gastrin
  • Gene name:  NA
  • Organism:  Gallus gallus (Chicken)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DWPEPPSQEQQQRFISRFLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDF
  • Length:  53
  • Propeptide:  MKTKVFLGLILSAAVTACLCRPAAKAPGGSHRPTSSLARRDWPEPPSQEQQQRFISRFLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDFGRRSTEDAADAA
  • Signal peptide:  MKTKVFLGLILSAAVTACLC
  • Modification:  T47 Sulfotyrosine;T53 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent stimulus of gastric acid, but not of pancreatic secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09859-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000943_AF2.pdbhor000943_ESM.pdb

Physical Information

Mass: 723163 Formula: C289H407N77O82S
Absent amino acids: CT Common amino acids: FDPQ
pI: 4.56 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 18
Hydrophobicity: -78.49 Boman Index: -11487
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 51.51
Instability Index: 4851.13 Extinction Coefficient cystines: 12490
Absorbance 280nm: 240.19

Literature

  • PubMed ID:  1523171
  • Title:  Identification of four chicken gastrins, obtained by processing at post-Phe bonds.